] ] { "}); "context" : "", "useSimpleView" : "false", }, } count++; ] }, "actions" : [ } } "event" : "addMessageUserEmailSubscription", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }); //$('#lia-body').removeClass('lia-window-scroll'); { "action" : "rerender" Handy habe ich schon mehrmals neu gestartet und die mobilen Daten ein und ausgeschalten aber verändern tut sich da nix. "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vSnBfPImU3dvC01AS_1qZ6pyaqfWc6uWBhwHzFED8RE. "action" : "pulsate" Bis 1. { { "context" : "lia-deleted-state", }, ] ] Execute whatever should happen when entering the right sequence } { "actions" : [ { "action" : "rerender" "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,expandedQuiltName", }, { "actions" : [ "actions" : [ }, Ich habe bereits bei Vodafone angerufen und wurde damit vertröstet es sei eine Lokale Störung (Welche seit ca. LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { ] }, { ] "actions" : [ ] } ] } "kudosable" : "true", Hey Leute, ich habe seit dem letzten Update (iOS 13.4.1) das Problem dass meine mobile Daten sehr langsam sind. { $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() ] "actions" : [ "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" if(do_scroll == "true"){ ] "context" : "", { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }); { "actions" : [ "actions" : [ ] "messageViewOptions" : "1111110111111111111110111110100101001101" { "entity" : "1677616", "context" : "", "actions" : [ }, "action" : "pulsate" ] watching = false; { "event" : "MessagesWidgetEditAction", // Oops. { return; "action" : "rerender" "action" : "pulsate" "actions" : [ } "includeRepliesModerationState" : "false", { "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName", "action" : "pulsate" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "event" : "ProductAnswerComment", { } "message" : "1676781", "action" : "rerender" { "initiatorBinding" : true, "action" : "rerender" "action" : "pulsate" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "eventActions" : [ }, }, { "action" : "rerender" })(LITHIUM.jQuery); }, LITHIUM.Dialog.options['1295786416'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234512}); Ist vielleicht etwas an meinem Router falsch eingestellt, da der Upload so extrem hoch ist. Viele Grüße "action" : "rerender" "context" : "", "context" : "", ] { "defaultAriaLabel" : "", "context" : "envParam:quiltName", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "selector" : "#kudosButtonV2", "actions" : [ })(LITHIUM.jQuery); { { "disableLabelLinks" : "false", "actions" : [ { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" "actions" : [ "context" : "envParam:quiltName", ] "event" : "kudoEntity", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "componentId" : "kudos.widget.button", "useSimpleView" : "false", ] "event" : "kudoEntity", "componentId" : "kudos.widget.button", Ich bin es allerdings leid jeden Tag mein Handy durchzustarten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); { ] "disableLinks" : "false", "}); Bist du sicher, dass du fortfahren möchtest? if ( !watching ) { ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1676781 .lia-rating-control-passive', '#form_2'); "actions" : [ "event" : "MessagesWidgetMessageEdit", "actions" : [ "action" : "rerender" "action" : "pulsate" "action" : "rerender" }, "useSubjectIcons" : "true", Lies den Vertrag. { } "action" : "rerender" "context" : "envParam:quiltName", Ist Vodafone down? "kudosLinksDisabled" : "false", ] "event" : "MessagesWidgetAnswerForm", { } "actions" : [ "useTruncatedSubject" : "true", ] { } "actions" : [ { "action" : "rerender" ] "actions" : [ "}); "actions" : [ { { { { { } "event" : "MessagesWidgetCommentForm", { "parameters" : { "actions" : [ "context" : "", { "action" : "rerender" { { }); LITHIUM.AjaxSupport.useTickets = false; }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_0", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); ] Warum funktioniert convert2mp3net nicht mehr? "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } } LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "context" : "", "action" : "pulsate" "parameters" : { "action" : "rerender" { "entity" : "1677804", { }); ] ], "selector" : "#messageview_0", "event" : "unapproveMessage", ] "action" : "rerender" }, { ] "event" : "ProductMessageEdit", { LITHIUM.Dialog.options['-1227855642'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "context" : "envParam:selectedMessage", "event" : "markAsSpamWithoutRedirect", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676295}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676781}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677616}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677804}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519069}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518535}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517764}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519947}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518973}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518744}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518298}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518127}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517837}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517792}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516597}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516406}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516271}}]); } { "truncateBody" : "true", }, "context" : "envParam:quiltName,expandedQuiltName", "event" : "markAsSpamWithoutRedirect", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Der Uploadstream sinkt kaum merklich auf 4Mbits. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/62553","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LtyIno34msRHXMmhpQ9S544leTXaTAszCkkRrasfd1c. }, } "selector" : "#messageview", "context" : "", } { "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ Bist du sicher, dass du fortfahren möchtest? Update vom Montag, 23.11.2020, 18.54 Uhr: Vodafone scheint das Problem langsam in den Griff zu bekommen. April 2015 ist Kabel Deutschland (Kabeldeutschland) eine Tochter von Vodafone. "actions" : [ } { { ] "context" : "envParam:feedbackData", { element.find('li').removeClass('active'); "}); } //$('#vodafone-community-header').css('display','block'); // We're good so far. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", "selector" : "#kudosButtonV2_4", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", { Da müsste doch ein Download von 6 MByte/s möglich sein!? "kudosLinksDisabled" : "false", Mir ist aber auch aufgefallen das auf dem Handy das Internet (über mobile Daten) langsamer geworden IST. mehr als genug. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "actions" : [ "event" : "markAsSpamWithoutRedirect", "disallowZeroCount" : "false", "actions" : [ ] "initiatorBinding" : true, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { "action" : "rerender" { }, var key = e.keyCode; count++; "action" : "rerender" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ element.children('ul').slideDown(); LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { '; "disableKudosForAnonUser" : "false", "quiltName" : "ForumMessage", if (element.hasClass('active')) { "context" : "", }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "initiatorDataMatcher" : "data-lia-message-uid" "event" : "addMessageUserEmailSubscription", ] { } }, { } "kudosLinksDisabled" : "false", "selector" : "#messageview_1", { "truncateBodyRetainsHtml" : "false", Ich schließe ihn an, verbinde mich mit den Handy und per LAN an meinen Rechner und siehe da: 1MB/s. "context" : "", { } { { { Bist du sicher, dass du fortfahren möchtest? ] ] "action" : "rerender" //$('#community-menu-toggle').removeClass('active') LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "entity" : "1677804", { "truncateBodyRetainsHtml" : "false", ] $('#vodafone-community-header').toggle(); { "action" : "rerender" "useSubjectIcons" : "true", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "event" : "approveMessage", }, "event" : "expandMessage", { ] LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] }, "actions" : [ "context" : "", "actions" : [ "event" : "addMessageUserEmailSubscription", } "action" : "rerender" }, "event" : "MessagesWidgetEditCommentForm", }, { "action" : "rerender" "parameters" : { ] "eventActions" : [ "event" : "ProductAnswerComment", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "quiltName" : "ForumMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); }, { { "context" : "envParam:quiltName", }, } else { "actions" : [ } } ] "initiatorBinding" : true, } "context" : "", }, PS: Habe bereits auch meine alte Fritzbox (von 1&1) angeschlossen. }, if ( !watching ) { //$('#lia-body').addClass('lia-window-scroll'); "event" : "MessagesWidgetAnswerForm", "}); "actions" : [ "context" : "", { "context" : "", "actions" : [ "event" : "expandMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", // enable redirect to login page when "logmein" is typed into the void =) } } ] Juni gleicht die Verbindungsqualität einem Modemanschluss. ] "context" : "envParam:quiltName", "event" : "MessagesWidgetAnswerForm", LITHIUM.Dialog.options['1295786416'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "event" : "kudoEntity", }); }, }, } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1677616 .lia-rating-control-passive', '#form_3'); } "selector" : "#kudosButtonV2_1", "actions" : [ "actions" : [ "context" : "envParam:quiltName", ] } "event" : "MessagesWidgetAnswerForm", "initiatorBinding" : true, } else { "action" : "rerender" } "event" : "deleteMessage", { ', 'ajax'); "context" : "", Bist du sicher, dass du fortfahren möchtest? "parameters" : { "event" : "MessagesWidgetCommentForm", }, LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { "context" : "", } } } }, "displayStyle" : "horizontal", "actions" : [ "context" : "", "event" : "MessagesWidgetAnswerForm", } // We made it! "action" : "rerender" watching = false;

Geldaufnahme 7 Buchstaben, Screenshot Pc Windows 10, Wanderung Nesslegg Körbersee, Cargohose Herren Länge 36, Moxy Frankfurt City Center Bar, Berggasthaus Riederstein Speisekarte, Webcam Kienle Balderschwang, China-restaurant Peking Friedrichshafen Speisekarte,